PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10005886
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 247aa    MW: 28253.7 Da    PI: 10.044
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10005886genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.6e-18855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed llv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
      Lus10005886  8 KGPWTEQEDILLVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 55
                     79********************************************97 PP

2Myb_DNA-binding58.21.9e-1861106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++l v++++++G++ W++Iar+++ gRt++++k++w++++
      Lus10005886  61 RGKMTPQEEKLVVELHAKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 106
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.3355IPR017930Myb domain
SuperFamilySSF466899.54E-306102IPR009057Homeodomain-like
SMARTSM007175.2E-16757IPR001005SANT/Myb domain
PfamPF002498.9E-17855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-21962IPR009057Homeodomain-like
CDDcd001671.09E-111055No hitNo description
PROSITE profilePS5129427.06256110IPR017930Myb domain
SMARTSM007175.2E-1760108IPR001005SANT/Myb domain
PfamPF002491.5E-1661105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-2463109IPR009057Homeodomain-like
CDDcd001674.83E-1263106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MIQDEVRKGP WTEQEDILLV NFVHLFGDRR WDFIAKVSGL NRTGKSCRLR WVNYLHPGLK  60
RGKMTPQEEK LVVELHAKWG NRWSRIARKL PGRTDNEIKN YWRTHMRKKA QERKRAVSSS  120
SSSNNSSASN TTTVDSSPFQ ETGDRSFYDT GGNNQVVVAA AAGKTNDSMQ VGDKGYSMDD  180
IWKDIENTIE PVSSAGFNDN FSGPAILSPP WEYNFHDTLW KLDTHSGSWT KRRVKRFFLM  240
TTEPCF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-2851101105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3745780.0GQ374578.1 Linum usitatissimum MYB1-2 mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012064973.11e-115PREDICTED: transcription factor MYB59 isoform X1
SwissprotQ9LX821e-89MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A067L6V81e-115A0A067L6V8_JATCU; MYB family protein
STRINGPOPTR_0001s24220.11e-109(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43783359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.17e-87myb domain protein 48